PDB entry 3esx

View 3esx on RCSB PDB site
Description: E16KE61KD126KD150K Flavodoxin from Anabaena
Class: electron transport
Keywords: ALPHA and BETA PROTEIN, Electron transport, Flavoprotein, FMN, Transport
Deposited on 2008-10-06, released 2009-02-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (Start-168)
      • engineered (15)
      • engineered (60)
      • engineered (125)
      • engineered (149)
    Domains in SCOPe 2.01: d3esxa_
  • Chain 'B':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (0-168)
      • engineered (15)
      • engineered (60)
      • engineered (125)
      • engineered (149)
    Domains in SCOPe 2.01: d3esxb_
  • Heterogens: FMN, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3esxA (A:)
    skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgykfndskalrngkfvglaldednqskltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3esxA (A:)
    kkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnigk
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgykfndskalrngkfvglaldednqskltddrikswvaqlksefgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3esxB (B:)
    skkiglfygtqtgktksvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    klqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgykfndskalrngkfvglaldednqskltddrikswvaqlksefgl