PDB entry 3esk

View 3esk on RCSB PDB site
Description: Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
Class: chaperone
Keywords: TPR2A, Hsp90, Hsc70, tetratricopeptide repeat, Nucleus, TPR repeat, Chaperone, Stress response
Deposited on 2008-10-06, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.183
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stress-induced-phosphoprotein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: STIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31948 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3eska1, d3eska2
  • Chain 'B':
    Compound: Heat shock cognate 71 kDa protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eskA (A:)
    gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
    cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
    aekilkeqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eskA (A:)
    gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
    cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
    aekilkeq
    

  • Chain 'B':
    No sequence available.