SCOPe 2.05: Structural Classification of Proteins

PDB entry 3es8

View 3es8 on RCSB PDB site
Description: Crystal structure of divergent enolase from Oceanobacillus Iheyensis complexed with Mg and L-malate.
Class: Isomerase, lyase
Keywords: Structural genomics, NYSGRC, target 9375a, enolase superfamily, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Isomerase, lyase
Deposited on 2008-10-04, released 2008-10-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8a1, d3es8a2
Chain 'B':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8b1, d3es8b2
Chain 'C':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8c1, d3es8c2
Chain 'D':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8d1, d3es8d2
Chain 'E':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8e1, d3es8e2
Chain 'F':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8f1, d3es8f2
Chain 'G':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8g1, d3es8g2
Chain 'H':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d3es8h1, d3es8h2
Heterogens: LMR, MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3es8A (A:)
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
esllakyqvpdlswdnvtvhqlqdrtadtks