PDB entry 3es6

View 3es6 on RCSB PDB site
Description: Crystal structure of the novel complex formed between Zinc 2-glycoprotein (ZAG) and Prolactin inducible protein (PIP) from human seminal plasma
Class: cell adhesion
Keywords: Major histocompatibility complex, Protein-protein complex, Prolactin Inducible protein, Zinc 2-glycoprotein, ZAG-PIP complex, Glycoprotein, Pyrrolidone carboxylic acid, Secreted, Actin-binding, CELL ADHESION
Deposited on 2008-10-04, released 2008-10-28
The last revision prior to the SCOP 1.75 freeze date was dated 2008-11-25, with a file datestamp of 2008-11-21.
Experiment type: XRAY
Resolution: 3.23 Å
R-factor: 0.2
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc-alpha-2-glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25311 (0-End)
      • modified residue (0)
  • Chain 'B':
    Compound: Prolactin-inducible protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3es6b1
  • Heterogens: CO3, P6G

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3es6B (B:)
    qdntrkiiiknfdipksvrpndevtavlavqtelkecmvvktylissiplqgafnykyta
    clcddnpktfywdfytnrtvqiaavvdvirelgicpddaavipiknnrfytieilkve