PDB entry 3es4

View 3es4 on RCSB PDB site
Description: crystal structure of protein of unknown function (duf861) with a rmlc- like cupin fold (17741406) from agrobacterium tumefaciens str. c58 (dupont) at 1.64 a resolution
Deposited on 2008-10-03, released 2008-10-14
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uncharacterized protein DUF861 with a RmlC-like cupin fold
  Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
  Gene: 17741406, AGR_L_3519, Atu3045
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9CEL1 (1-115)
    • leader sequence (0)
• Chain 'B':
  Compound: uncharacterized protein DUF861 with a RmlC-like cupin fold
  Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
  Gene: 17741406, AGR_L_3519, Atu3045
  Database cross-references and differences (RAF-indexed):
  • Uniprot A9CEL1 (1-115)
    • leader sequence (0)
• Heterogens: CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3es4A (A:)
  gmtmpifnisddvdlvpampaegrdggsyrrqiwqddvengtivavwmaepgiynyagrd
  leetfvvvegealysqadadpvkigpgsivsiakgvpsrleilssfrklatvipkp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >3es4B (B:)
  gmtmpifnisddvdlvpampaegrdggsyrrqiwqddvengtivavwmaepgiynyagrd
  leetfvvvegealysqadadpvkigpgsivsiakgvpsrleilssfrklatvipkp