PDB entry 3es1

View 3es1 on RCSB PDB site
Description: crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution
Deposited on 2008-10-03, released 2008-10-14
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cupin 2, conserved barrel domain protein
    Species: Novosphingobium aromaticivorans DSM 12444 [TaxId:279238]
    Gene: YP_001165807.1, Saro_3421,
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3es1A (A:)
gmsealsdsglppvqrvvtghdahgravfksedvtptrmipsgdasfllvwttatvpadn
ndetdgrqreagltldggsvirvvdmlpgkespmhrtnsidygivlegeielelddgakr
tvrqggiivqrgtnhlwrnttdkpcriafilieapaylhngqplpedkpdhk

    Sequence, based on observed residues (ATOM records):
    >3es1A (A:)
ealsdsglppvqrvvtghdahgravfksedvtptrmipsgdasfllvwttatvpadnnde
tdgrqreagltldggsvirvvdmlpgkespmhrtnsidygivlegeielelddgakrtvr
qggiivqrgtnhlwrnttdkpcriafilieapaylhngqplpe