PDB entry 3erx

View 3erx on RCSB PDB site
Description: High-resolution structure of Paracoccus pantotrophus pseudoazurin
Class: electron transport
Keywords: pseudoazurin, copper protein, Paracoccus, high-resolution, Electron transport, Metal-binding, Transport
Deposited on 2008-10-03, released 2009-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.189
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Gene: pazS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3erxa_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Gene: pazS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3erxb_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3erxA (A:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3erxB (B:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn