PDB entry 3ert

View 3ert on RCSB PDB site
Description: human estrogen receptor alpha ligand-binding domain in complex with 4-hydroxytamoxifen
Deposited on 1999-03-30, released 1999-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-08, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3erta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ertA (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
    ahrlhap