PDB entry 3ers

View 3ers on RCSB PDB site
Description: Crystal Structure of E. coli Trbp111
Class: RNA binding protein
Keywords: oligonucleotide-oligosaccharide binding fold, RNA-binding, tRNA-binding, RNA BINDING PROTEIN
Deposited on 2008-10-03, released 2008-12-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-12-02, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.22
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: tRNA-binding protein ygjH
    Species: Escherichia coli [TaxId:562]
    Gene: YGJH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42589 (0-109)
      • expression tag (110-111)
    Domains in SCOPe 2.05: d3ersx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3ersX (X:)
    metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
    ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvvldhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ersX (X:)
    metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
    ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvvld