PDB entry 3erd

View 3erd on RCSB PDB site
Description: human estrogen receptor alpha ligand-binding domain in complex with diethylstilbestrol and a glucocorticoid receptor interacting protein 1 nr box ii peptide
Deposited on 1999-03-31, released 1999-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-08, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3erda_
  • Chain 'B':
    Domains in SCOP 1.55: d3erdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3erdA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahrlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3erdB (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3erdB (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytfeekdhihrvldkitdtlihlmak
    agltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahrlh