PDB entry 3era

View 3era on RCSB PDB site
Description: recombinant erabutoxin a (s8t mutant)
Class: neurotoxin
Keywords: snake neurotoxin, venom, postsynaptic neurotoxin
Deposited on 1997-06-25, released 1997-12-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: erabutoxin a
  Species: Laticauda semifasciata [TaxId:8631]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60775 (0-61)
    • engineered (7)
  Domains in SCOPe 2.08: d3eraa_
• Chain 'B':
  Compound: erabutoxin a
  Species: Laticauda semifasciata [TaxId:8631]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60775 (0-61)
    • engineered (7)
  Domains in SCOPe 2.08: d3erab_
• Heterogens: SCN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3eraA (A:)
  ricfnhqtsqpqttktcspgesscynkqwsdfrgtiiergcgcptvkpgiklsccesevc
  nn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3eraB (B:)
  ricfnhqtsqpqttktcspgesscynkqwsdfrgtiiergcgcptvkpgiklsccesevc
  nn