PDB entry 3eqs

View 3eqs on RCSB PDB site
Description: Crystal structure of human MDM2 in complex with a 12-mer peptide inhibitor
Deposited on 2008-10-01, released 2009-03-17
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.156
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 12-mer peptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3EQS (0-End)
  • Heterogens: GAI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3eqsA (A:)
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

    Sequence, based on observed residues (ATOM records):
    >3eqsA (A:)
tlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
fgvpsfsvkehrkiytmiyrnlvv

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3eqsB (B:)
tsfaeywnllsp

    Sequence, based on observed residues (ATOM records):
    >3eqsB (B:)
tsfaeywnlls