PDB entry 3eq7

View 3eq7 on RCSB PDB site
Description: Prolyl oligopeptidase complexed with R-Pro-(decarboxy-Pro)-Type inhibitors
Class: hydrolase
Keywords: protease-inhibitor complex, Hydrolase, Protease, Serine protease
Deposited on 2008-09-30, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eq7a1, d3eq7a2
  • Heterogens: X99, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eq7A (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltinggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eq7A (A:)
    fqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpirgly
    kermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnilsddg
    tvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawthdgk
    gmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggaelsdd
    gryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvftfk
    tnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvkntlql
    hdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeeleprvfr
    evtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpn
    ysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegyt
    spkrltinggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsd
    skqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrs
    rkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip