PDB entry 3eox

View 3eox on RCSB PDB site
Description: High quality structure of cleaved PAI-1-stab
Class: blood clotting
Keywords: cleaved plasminogen activator inhibitor-1, PAI-1, Serpin, Stabilized, Glycoprotein, Plasminogen activation, Protease inhibitor, Secreted, Serine protease inhibitor, BLOOD CLOTTING
Deposited on 2008-09-29, released 2009-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.204
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (0-378)
      • engineered (149)
      • engineered (153)
      • engineered (300)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.06: d3eoxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eoxA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    pfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eoxA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlftvk
    qvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpds
    sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
    kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpf
    qadftslsdqeplhvalalqkvkievnesgtvassstaviveiiidrpflfvvrhnptgt
    vlfmgqvmep