PDB entry 3eor

View 3eor on RCSB PDB site
Description: Crystal structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Class: lyase
Keywords: MECDP-synthase, lysase, Isoprene biosynthesis, Lyase, Magnesium, Manganese, Metal-binding
Deposited on 2008-09-29, released 2009-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62617 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.08: d3eora1, d3eora2
  • Heterogens: ZN, NA, CFV, GPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eorA (A:)
    gshmlemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaal
    gdigklfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrv
    fiaedlgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eorA (A:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik