PDB entry 3eod

View 3eod on RCSB PDB site
Description: Crystal structure of N-terminal domain of E. coli RssB
Class: signaling protein
Keywords: response regulator, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on 2008-09-26, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hnr
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: b1235, hnr, JW1223, rssb, ychL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3eoda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eodA (A:)
    mtqplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdia
    mprmnglkllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvkdlnrlremv
    faclypsmfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eodA (A:)
    qplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiagl
    kllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvnrlremvfacly