PDB entry 3eoa

View 3eoa on RCSB PDB site
Description: Crystal structure the Fab fragment of Efalizumab in complex with LFA-1 I domain, Form I
Class: immune system/cell adhesion
Keywords: Efalizumab, Fab, antibody, LFA-1, CD11a, I domain, Alternative splicing, Calcium, Glycoprotein, Integrin, Magnesium, Membrane, Polymorphism, Receptor, Transmembrane, IMMUNE SYSTEM/CELL ADHESION COMPLEX
Deposited on 2008-09-26, released 2009-04-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Efalizumab Fab fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EOA (0-213)
    Domains in SCOPe 2.06: d3eoaa1, d3eoaa2
  • Chain 'B':
    Compound: Efalizumab Fab fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EOA (0-219)
  • Chain 'H':
    Compound: Efalizumab Fab fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EOA (0-219)
  • Chain 'I':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eoai_
  • Chain 'J':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3eoaj_
  • Chain 'L':
    Compound: Efalizumab Fab fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 3EOA (0-213)
    Domains in SCOPe 2.06: d3eoal1, d3eoal2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eoaA (A:)
    diqmtqspsslsasvgdrvtitcrasktiskylawyqqkpgkapklliysgstlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqhneypltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3eoaI (I:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eoaI (I:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3eoaJ (J:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eoaJ (J:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eoaL (L:)
    diqmtqspsslsasvgdrvtitcrasktiskylawyqqkpgkapklliysgstlqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqhneypltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec