PDB entry 3eo6

View 3eo6 on RCSB PDB site
Description: crystal structure of protein of unknown function (duf1255) (afe_2634) from acidithiobacillus ferrooxidans ncib8455 at 0.97 a resolution
Deposited on 2008-09-26, released 2008-10-07
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein of unknown function (DUF1255)
    Species: Acidithiobacillus ferrooxidans ATCC 23270 [TaxId:243159]
    Gene: AFE_2634
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO6 (0-105)
  • Chain 'B':
    Compound: protein of unknown function (DUF1255)
    Species: Acidithiobacillus ferrooxidans ATCC 23270 [TaxId:243159]
    Gene: AFE_2634
    Database cross-references and differences (RAF-indexed):
    • PDB 3EO6 (0-105)
  • Heterogens: MG, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3eo6A (A:)
gmapdqqvpatalgkssrisldgrrsersviladgsmhsltllhpgvytlssevaetirv
lsgmayyhaegandvqelhagdsmvipanqsyrlevmepldyllss

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3eo6B (B:)
gmapdqqvpatalgkssrisldgrrsersviladgsmhsltllhpgvytlssevaetirv
lsgmayyhaegandvqelhagdsmvipanqsyrlevmepldyllss