PDB entry 3enu

View 3enu on RCSB PDB site
Description: crystal structure of nitrollin, a betagamma-crystallin from nitrosospira multiformis
Deposited on 2008-09-26, released 2009-03-31
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Nitrosospira multiformis [TaxId:323848]
    Gene: 3786576
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3enuA (A:)
tievpvltfvpvqvsaelenrgcwvkffdkknfqgdslflsgpatlprligpfgydwenk
vrsvkvgpranltifdnhnyrdedkfldaganvanlskemgffdnfrsmvlnci