PDB entry 3enn

View 3enn on RCSB PDB site
Description: 2.1A crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212)
Class: oxidoreductase
Keywords: BRUCELLA, MELITENSIS, GLUCOSE, RIBITOL, DEHYDROGENASE, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, SSGCID, Oxidoreductase
Deposited on 2008-09-25, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477, BRUCELLA MELITENSIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFP3 (4-248)
      • expression tag (3)
    Domains in SCOPe 2.05: d3enna_
  • Chain 'B':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477, BRUCELLA MELITENSIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFP3 (4-248)
      • expression tag (1-3)
    Domains in SCOPe 2.05: d3ennb_
  • Chain 'C':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477, BRUCELLA MELITENSIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFP3 (4-248)
      • expression tag (3)
    Domains in SCOPe 2.05: d3ennc_
  • Chain 'D':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477, BRUCELLA MELITENSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ennd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ennA (A:)
    gpgsmfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifv
    fpanlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvf
    nltrelthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvt
    vnciapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtl
    hvnggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ennA (A:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfieskqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ennB (B:)
    gpgsmfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifv
    fpanlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvf
    nltrelthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvt
    vnciapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtl
    hvnggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ennB (B:)
    pgsmfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvf
    panlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfn
    ltrelthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtv
    nciapgfiesnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggma
    mi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ennC (C:)
    gpgsmfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifv
    fpanlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvf
    nltrelthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvt
    vnciapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtl
    hvnggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ennC (C:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfiekdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ennD (D:)
    gpgsmfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifv
    fpanlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvf
    nltrelthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvt
    vnciapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtl
    hvnggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ennD (D:)
    mfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpan
    lsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnltr
    elthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnci
    apgfiekdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami