PDB entry 3enk

View 3enk on RCSB PDB site
Description: 1.9A crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
Class: isomerase
Keywords: BURKHOLDERIA, PSEUDOMALLEI, UDP-GLUCOSE, EPIMERASE, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, SSGCID, Isomerase, NAD
Deposited on 2008-09-25, released 2008-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucose 4-epimerase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3147, galE, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3enka_
  • Chain 'B':
    Compound: UDP-glucose 4-epimerase
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: BURPS1710B_2458, BURPS1710b_3147, galE, MSRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3enkb_
  • Heterogens: NAD, UPG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3enkA (A:)
    smstkgtilvtggagyigshtavellahgydvviadnlvnskreaiariekitgktpafh
    etdvsderalarifdahpitaaihfaalkavgesvakpieyyrnnldsllsllrvmrera
    vkrivfsssatvygvperspidetfplsatnpygqtklmaeqilrdveaadpswrvatlr
    yfnpvgahesgligedpagipnnlmpyvaqvavgkleklrvfgsdyptpdgtgvrdyihv
    vdlarghiaaldalerrdasltvnlgtgrgysvlevvrafekasgravpyelvarrpgdv
    aecyanpaaaaetigwkaerdlermcadhwrwqennprgfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3enkA (A:)
    mstkgtilvtggagyigshtavellahgydvviadnlvnskreaiariekitgktpafhe
    tdvsderalarifdahpitaaihfaalkavgesvakpieyyrnnldsllsllrvmrerav
    krivfsssatvygvperspidetfplsatnpygqtklmaeqilrdveaadpswrvatlry
    fnpvgahesgligedpagipnnlmpyvaqvavgkleklrvfgsdyptpdgtgvrdyihvv
    dlarghiaaldalerrdasltvnlgtgrgysvlevvrafekasgravpyelvarrpgdva
    ecyanpaaaaetigwkaerdlermcadhwrwqennprgfv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3enkB (B:)
    smstkgtilvtggagyigshtavellahgydvviadnlvnskreaiariekitgktpafh
    etdvsderalarifdahpitaaihfaalkavgesvakpieyyrnnldsllsllrvmrera
    vkrivfsssatvygvperspidetfplsatnpygqtklmaeqilrdveaadpswrvatlr
    yfnpvgahesgligedpagipnnlmpyvaqvavgkleklrvfgsdyptpdgtgvrdyihv
    vdlarghiaaldalerrdasltvnlgtgrgysvlevvrafekasgravpyelvarrpgdv
    aecyanpaaaaetigwkaerdlermcadhwrwqennprgfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3enkB (B:)
    mstkgtilvtggagyigshtavellahgydvviadnlvnskreaiariekitgktpafhe
    tdvsderalarifdahpitaaihfaalkavgesvakpieyyrnnldsllsllrvmrerav
    krivfsssatvygvperspidetfplsatnpygqtklmaeqilrdveaadpswrvatlry
    fnpvgahesgligedpagipnnlmpyvaqvavgkleklrvfgsdyptpdgtgvrdyihvv
    dlarghiaaldalerrdasltvnlgtgrgysvlevvrafekasgravpyelvarrpgdva
    ecyanpaaaaetigwkaerdlermcadhwrwqennprgf