PDB entry 3enj

View 3enj on RCSB PDB site
Description: Structure of Pig Heart Citrate Synthase at 1.78 A resolution
Class: lyase, transferase
Keywords: disulfide exchange, Structural Genomics, PSI-2, Protein Structure Initiative, Center for High-Throughput Structural Biology, CHTSB, Methylation, Mitochondrion, Transferase, Transit peptide, Tricarboxylic acid cycle, LYASE
Deposited on 2008-09-25, released 2009-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3enja_
  • Heterogens: CYS, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3enjA (A:)
    asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp
    degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
    pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
    klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
    lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
    lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmstdgliklvdsk