PDB entry 3en8

View 3en8 on RCSB PDB site
Description: Crystal structure of NTF-2 like protein of unknown function (YP_553245.1) from BURKHOLDERIA XENOVORANS LB400 at 1.85 A resolution
Class: structural genomics, unknown function
Keywords: YP_553245.1, NTF-2 like protein of unknown function, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2008-09-25, released 2008-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uncharacterized NTF-2 like protein
  Species: Burkholderia xenovorans LB400 [TaxId:266265]
  Gene: YP_553245.1, Bxeno_B0927, Bxe_B2092
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13PU4 (1-127)
    • leader sequence (0)
  Domains in SCOPe 2.08: d3en8a1, d3en8a2
• Heterogens: CA, ACT, PEG, PG4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3en8A (A:)
  gmreekirealnahwqasaagdfdaehdiydddaicdypqsgerilgrmnlqalrshhpg
  kpagfevrriqgegnlwiteysisyngrpaytvsimefrngkvvhetqyfsdpfeapgwr
  sqwvqqig