PDB entry 3en4

View 3en4 on RCSB PDB site
Description: Targeted polypharmacology: crystal structure of the c-Src kinase domain in complex with PP121, a multitargeted kinase inhibitor
Class: transferase
Keywords: SRC, tyrosine, kinase, polypharmacology, inhibitor, multitarget, phosphoinositide, transferase, signaling, pyrazolopyrimidine, kinase-inhibitor complex, ATP-binding, Lipoprotein, Myristate, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Tyrosine-protein kinase
Deposited on 2008-09-25, released 2008-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.201
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3en4a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3en4b_
  • Heterogens: KS1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3en4A (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3en4A (A:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpmspeaflqeaqvmkklrh
    eklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayver
    mnyvhrdlraanilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgilltelt
    tkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafl
    edyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3en4B (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3en4B (B:)
    kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
    lrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmay
    vermnyvhrdlraanilvgenlvckvadfglarlakfpikwtapeaalygrftiksdvws
    fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerp
    tfeylqafledyftstepqyqpgenl