PDB entry 3en3

View 3en3 on RCSB PDB site
Description: Crystal Structure of the GluR4 Ligand-Binding domain in complex with kainate
Class: membrane protein
Keywords: GluR4, AMPA receptor, ligand-gated ion channel, ligand-binding domain, Kainate, Cell junction, Cell membrane, Glycoprotein, Ion transport, Ionic channel, Lipoprotein, MEMBRANE PROTEIN
Deposited on 2008-09-25, released 2009-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glutamate receptor 4,Glutamate receptor
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Glur4,Glutamate receptor
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19493 (0-112)
    • linker (113-114)
  • Uniprot P19493 (115-256)
    • variant (226-228)
    • variant (237)
    • variant (239)
    • variant (241)
  Domains in SCOPe 2.08: d3en3a_
• Heterogens: KAI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3en3A (A:)
  tvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkygar
  dadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpiesa
  edlakqteiaygtldsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrks
  kgkfafllestmneyteqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklsea
  gvldklknkwwydkgec