PDB entry 3emy

View 3emy on RCSB PDB site
Description: Crystal structure of Trichoderma reesei aspartic proteinase complexed with pepstatin A
Class: hydrolase/hydrolase inhibitor
Keywords: Trichoderma reesei, aspartic proteinase, Aspartyl protease, Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2008-09-25, released 2008-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trichoderma reesei Aspartic protease
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3emya_
  • Chain 'B':
    Compound: pepstatin
    Species: Streptomyces argenteolus subsp. toyonakensis, synthetic [TaxId:285516]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EMY (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3emyA (A:)
etgsapnhpsdsadseyitsvsigtpaqvlpldfdtgssdlwvfssetpkssatghaiyt
psksstskkvsgaswsisygdgssssgdvytdkvtiggfsvntqgvesatrvstefvqdt
visglvglafdsgnqvrphpqktwfsnaasslaeplftadlrhgqngsynfgyidtsvak
gpvaytpvdnsqgfweftasgysvgggklnrnsidgiadtgttllllddnvvdayyanvq
saqydnqqegvvfdcdedlpsfsfgvgsstitipgdllnltpleegsstcfgglqsssgi
ginifgdvalkaalvvfdlgnerlgwaqk

  • Chain 'B':
    No sequence available.