PDB entry 3emu

View 3emu on RCSB PDB site
Description: crystal structure of a leucine rich repeat and phosphatase domain containing protein from entamoeba histolytica
Deposited on 2008-09-25, released 2008-10-14
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine rich repeat and phosphatase domain containing protein
    Species: Entamoeba histolytica
    Gene: EHI_044170
    Database cross-references and differences (RAF-indexed):
    • PDB 3EMU
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3emuA (A:)
msltfptlsptqiiqyihlgsflnahnvdyihnnnissillvgievpslfkdqcdilrld
ivseeghqlydsipnaikfiirsiqrkegvliisgtgvnkapaiviaflmyyqrlsfina
fnkvqglyplidiesgfilqlklfekklekmnseghhhhhh

    Sequence, based on observed residues (ATOM records):
    >3emuA (A:)
tfptlsptqiiqyihlgsflnahnvdyihnnnissillvgkdqcdilrldivseeghqly
dsipnaikfiirsiqrkegvliisgtgvnkapaiviaflmyyqrlsfinafnkvqglypl
idiesgfilqlklfekklekmnse