PDB entry 3emm

View 3emm on RCSB PDB site
Description: X-ray structure of protein from Arabidopsis thaliana AT1G79260 with Bound Heme
Class: structural genomics, unknown function
Keywords: HEME, Unknown Function, Structural Genomics Functional Follow-up Study, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2008-09-24, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein At1g79260
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g79260, YUP8H12R.14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3emma_
  • Heterogens: HEM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3emmA (A:)
mnqlqqlqnpgesppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpvi
aytqktwklesgapmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksd
lvgnaskvkeisrefelvdgklsyvvrmstttnplqphlkaildkl

    Sequence, based on observed residues (ATOM records): (download) 
    >3emmA (A:)
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrmstttnplqphlkaildkl