PDB entry 3emk

View 3emk on RCSB PDB site
Description: 2.5A crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
Class: oxidoreductase
Keywords: BRUCELLA, MELITENSIS, GLUCOSE, RIBITOL, DEHYDROGENASE, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, SSGCID, Oxidoreductase
Deposited on 2008-09-24, released 2008-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFP3 (1-245)
      • expression tag (0)
    Domains in SCOPe 2.05: d3emka_
  • Chain 'B':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFP3 (1-245)
      • expression tag (0)
    Domains in SCOPe 2.05: d3emkb_
  • Chain 'C':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFP3 (1-245)
      • expression tag (0)
    Domains in SCOPe 2.05: d3emkc_
  • Chain 'D':
    Compound: glucose/ribitol dehydrogenase
    Species: Brucella melitensis [TaxId:29459]
    Gene: BMEI1477
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YFP3 (1-245)
      • expression tag (0)
    Domains in SCOPe 2.05: d3emkd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3emkA (A:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvn
    ggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3emkA (A:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfiesamekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmam
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3emkB (B:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvn
    ggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3emkB (B:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtrelkelaaelgerifvfpanl
    sdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnltre
    lthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvncia
    pgfikdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3emkC (C:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvn
    ggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3emkC (C:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3emkD (D:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvn
    ggmami
    

    Sequence, based on observed residues (ATOM records): (download)
    >3emkD (D:)
    smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
    nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
    relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
    iapgfieekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami