PDB entry 3eme

View 3eme on RCSB PDB site
Description: Crystal Structure of Rhodanese-like Domain Protein from Staphylococcus aureus
Deposited on 2008-09-24, released 2008-10-07
The last revision was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhodanese-like domain protein
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: SACOL1807
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BME, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3emeA (A:)
mksittdelknklleskpvqivdvrtdeetamgyipnaklipmdtipdnlnsfnkneiyy
ivcaggvrsakvveyleangidavnveggmhawgdegleiksi

    Sequence, based on observed residues (ATOM records):
    >3emeA (A:)
mksittdelknklleskpvqivdvrtdeetamgyipnaklipmdtipdnlnsfnkneiyy
ivcaggvrsakvveyleangidavnveggmhawgdegleiks