PDB entry 3em6

View 3em6 on RCSB PDB site
Description: Crystal structure of I50L/A71V mutant of hiv-1 protease in complex with inhibitor darunavir
Class: hydrolase
Keywords: protease inhibitor, hyper susceptibility, drug resistance, hiv, darunavir, AIDS, Hydrolase, Protease
Deposited on 2008-09-23, released 2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol, HIV-1 subtype B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (49)
    • engineered (70)
  Domains in SCOPe 2.08: d3em6a_
• Chain 'B':
  Compound: Protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol, HIV-1 subtype B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (49)
    • engineered (70)
  Domains in SCOPe 2.08: d3em6b_
• Heterogens: 017, PO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3em6A (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmigglggfikvrqyd
  qipveicghkvigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3em6B (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmigglggfikvrqyd
  qipveicghkvigtvlvgptpvniigrnlltqigctlnf