PDB entry 3elx

View 3elx on RCSB PDB site
Description: Crystal structure of apo Zebrafish Ileal Bile Acid-Binding Protein
Class: lipid binding protein
Keywords: ileal bile acid-bindign protein, zebrafish, cholic acid, Lipid-binding, Transport, LIPID BINDING PROTEIN
Deposited on 2008-09-23, released 2009-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.204
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ileal bile acid-binding protein
    Species: Danio rerio [TaxId:7955]
    Gene: fabp6, zgc:92421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IMW5 (4-133)
      • expression tag (2-3)
      • expression tag (134-135)
    Domains in SCOPe 2.08: d3elxa1, d3elxa2, d3elxa3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3elxA (A:)
mrgsafngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnn
hvvtnkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasg
aqgtavlvrtskkvlvpr

    Sequence, based on observed residues (ATOM records): (download) 
    >3elxA (A:)
gsafngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnnhv
vtnkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasgaq
gtavlvrtskkvlv