PDB entry 3elo

View 3elo on RCSB PDB site
Description: Crystal Structure of Human Pancreatic Prophospholipase A2
Class: Hydrolase
Keywords: Human Pancreatic Prophospholipase A2, Trimeric, Hydrolase, Lipid degradation, Metal-binding, Secreted
Deposited on 2008-09-22, released 2009-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.147
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3eloa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eloA (A:)
    dsgispravwqfrkmikcvipgsdpfleynnygcycglggsgtpvdeldkccqthdncyd
    qakkldsckflldnpythtysyscsgsaitcssknkeceaficncdrnaaicfskapynk
    ahknldtkkycqs