PDB entry 3elk

View 3elk on RCSB PDB site
Description: Crystal structure of putative transcriptional regulator TA0346 from Thermoplasma acidophilum
Class: transcription regulator
Keywords: transcriptional regulator, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, transcription regulator
Deposited on 2008-09-22, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.204
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator TA0346
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3elka_
  • Chain 'B':
    Compound: Putative transcriptional regulator TA0346
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3elkb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3elkA (A:)
    mnsdptrerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmker
    gfvisessvnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvdiienrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3elkA (A:)
    trerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmkergfvis
    essvnkgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3elkB (B:)
    mnsdptrerilhglitlyilkelvkrpmhgyelqksmfettgqalpqgsiyillktmker
    gfvisessvnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvdiienrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3elkB (B:)
    erilhglitlyilkelvkrpmhgyelqksmfettgqalpgsiyillktmkergfvisess
    vnekgqqltvyhitdagkkflcdhsqalqlarkiiddllstvd