PDB entry 3elj

View 3elj on RCSB PDB site
Description: Jnk1 complexed with a bis-anilino-pyrrolopyrimidine inhibitor.
Class: transferase
Keywords: c-Jun N-terminal kinase, mitogen-activated protein kinase, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, JNK1
Deposited on 2008-09-22, released 2008-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK8, JNK1, PRKM8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3elja_
  • Heterogens: GS7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eljA (A:)
    gplgsmsrskrdnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaik
    klsrpfqnqthakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanl
    cqviqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglart
    agtsfmmtpyvvtryyrapevilgmgykenvdlwsvgcimgemvchkilfpgrdyidqwn
    kvieqlgtpcpefmkklqptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqar
    dllskmlvidaskrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkel
    iykevmdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eljA (A:)
    dnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqth
    akrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglsfmmtpyvvtryyr
    apevilgmgykenvdlwsvgcimgemvchkilfpgrdyidqwnkvieqlgtpcpefmkkl
    qptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvidaskrisv
    dealqhpyinvwydpseaeapppkiperehtieewkeliykevmdle