PDB entry 3eli

View 3eli on RCSB PDB site
Description: Crystal structure of the AHSA1 (SPO3351) protein from Silicibacter pomeroyi, Northeast Structural Genomics Consortium Target SiR160
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function
Deposited on 2008-09-22, released 2008-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aha1 domain protein
    Species: Silicibacter pomeroyi [TaxId:89184]
    Gene: SPO3351
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LN61 (Start-143)
      • expression tag (144-146)
    Domains in SCOPe 2.06: d3elia1, d3elia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eliA (A:)
    madlrlerefavapealfawvsdgakllqwwgpeglhvpadqhdldftrlgpwfsvmvng
    egqrykvsgqvthvkppqsvgftwgwhddddrrgaeshvmfivepcakgarlildhrelg
    ddemslrheegwtsslrklaaelalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eliA (A:)
    adlrlerefavapealfawvsdgakllqwwgpeglhvpadqhdldftrlgpwfsvmvnge
    gqrykvsgqvthvkppqsvgftwgwhddddrrgaeshvmfivepcgarlildhrelgdde
    mslrheegwtsslrklaaelaleh