PDB entry 3ela

View 3ela on RCSB PDB site
Description: Crystal structure of active site inhibited coagulation factor VIIA mutant in complex with soluble tissue factor
Class: hydrolase/hydrolase inhibitor
Keywords: Serine protease, BLOOD CLOTTING, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2008-09-21, released 2008-11-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Coagulation factor VIIA heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08709 (0-253)
      • engineered (5)
      • engineered (143)
      • engineered (145)
    Domains in SCOPe 2.01: d3elah_
  • Chain 'L':
    Compound: Coagulation factor VIIA light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F7
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: tissue factor
    Species: Homo sapiens [TaxId:9606]
    Gene: F3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GLC, FUC, CA, 0Z6, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3elaH (H:)
    ivggkdcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd
    lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert
    lafvrfslvsgwgqlldrgatalvlqvlnvprlmtqdclqqsrkvgdspniteymfcagy
    sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr
    seprpgvllrapfp
    

  • Chain 'L':
    No sequence available.

  • Chain 'T':
    No sequence available.