PDB entry 3el9
View 3el9 on RCSB PDB site
Description: Crystal structure of atazanavir (ATV) in complex with a multidrug HIV-1 protease (V82T/I84V)
Class: hydrolase
Keywords: drug resistance, entropy enthalpy compensation, hiv protease, atazanavir, AIDS, Hydrolase
Deposited on
2008-09-21, released
2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d3el9a_ - Chain 'B':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d3el9b_ - Heterogens: DR7, ACT, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3el9A (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3el9B (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptptnvigrnlltqigctlnf