PDB entry 3el8

View 3el8 on RCSB PDB site
Description: Crystal structure of c-Src in complex with pyrazolopyrimidine 5
Class: transferase
Keywords: c-Src, Kinase, Pyrazolopyrimidine 5, ATP-binding, Lipoprotein, Myristate, Nucleotide-binding, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-09-20, released 2008-10-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3el8a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3el8b_
  • Heterogens: PD5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3el8A (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3el8A (A:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglarlfpikwtapeaalygrftiksdvwsfgi
    lltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfe
    ylqafledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3el8B (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3el8B (B:)
    akdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlpeaflqeaqvmkklrhek
    lvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermn
    yvhrdlraanilvgenlvckvadfglarlfpikwtapeaalygrftiksdvwsfgillte
    lttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqa
    fledyftstepqyqpgenl