PDB entry 3el5

View 3el5 on RCSB PDB site
Description: Crystal structure of nelfinavir (NFV) complexed with a multidrug variant (ACT) (V82T/I84V) of HIV-1 protease
Class: hydrolase
Keywords: protease inhibitor, drug resistance, nelfinavir, HIV-1 protease, entropy-enthalpy compensation, Hydrolase
Deposited on 2008-09-20, released 2009-09-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (40)
    • engineered (63)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.05: d3el5a_
• Chain 'B':
  Compound: Protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (40)
    • engineered (63)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.05: d3el5b_
• Heterogens: ACT, 1UN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3el5A (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptptnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3el5B (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptptnvigrnlltqigctlnf