PDB entry 3el4
View 3el4 on RCSB PDB site
Description: Crystal structure of inhibitor saquinavir (SQV) complexed with the multidrug HIV-1 protease variant L63P/V82T/I84V
Class: hydrolase/hydrolase inhibitor
Keywords: protease inhibitor, drug resistance, HIV protease, entropy-enthalpy compensation, AIDS, Hydrolase-Hydrolase inhibitor complex, Protease
Deposited on
2008-09-19, released
2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (63)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d3el4a_ - Chain 'B':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (63)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d3el4b_ - Heterogens: ROC, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3el4A (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3el4B (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf