PDB entry 3ekv
View 3ekv on RCSB PDB site
Description: Crystal structure of the wild type HIV-1 protease with the inhibitor, Amprenavir
Class: hydrolase
Keywords: protease inhibitor, drug resistance, amprenavir, HIV protease, AIDS, Protease, HYDROLASE
Deposited on
2008-09-19, released
2009-09-01
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-10-17, with a file datestamp of
2012-10-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (63)
Domains in SCOPe 2.04: d3ekva_ - Chain 'B':
Compound: Protease
Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (63)
Domains in SCOPe 2.04: d3ekvb_ - Heterogens: 478, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ekvA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ekvB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf