PDB entry 3ekp

View 3ekp on RCSB PDB site
Description: Crystal Structure of the inhibitor Amprenavir (APV) in complex with a multi-drug resistant HIV-1 protease variant (L10I/G48V/I54V/V64I/V82A)Refer: FLAP+ in citation
Class: hydrolase
Keywords: HIV-1, protease, multi-drug resistance, Amprenavir, AIDS, HYDROLASE
Deposited on 2008-09-19, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (9)
      • engineered (47)
      • engineered (53)
      • engineered (63)
      • engineered (81)
    Domains in SCOPe 2.07: d3ekpa_
  • Chain 'B':
    Compound: Protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (9)
      • engineered (47)
      • engineered (53)
      • engineered (63)
      • engineered (81)
    Domains in SCOPe 2.07: d3ekpb_
  • Chain 'C':
    Compound: Protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (9)
      • engineered (47)
      • engineered (53)
      • engineered (63)
      • engineered (81)
    Domains in SCOPe 2.07: d3ekpc_
  • Chain 'D':
    Compound: Protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
      • engineered (9)
      • engineered (47)
      • engineered (53)
      • engineered (63)
      • engineered (81)
    Domains in SCOPe 2.07: d3ekpd_
  • Heterogens: PO4, ACT, 478, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ekpA (A:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ekpB (B:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ekpC (C:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ekpD (D:)
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf