PDB entry 3ekn

View 3ekn on RCSB PDB site
Description: Insulin receptor kinase complexed with an inhibitor
Class: transferase
Keywords: insulin, tyrosine kinase, ATP-binding, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Disease mutation, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-09-19, released 2008-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-306)
      • engineered (155)
      • see remark 999 (274)
    Domains in SCOPe 2.05: d3ekna_
  • Heterogens: GS3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eknA (A:)
    gvfpssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesa
    slrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeae
    nnpgrppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrd
    iyetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsne
    qvlkfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsf
    fhseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eknA (A:)
    yvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerie
    flneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrpp
    ptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrdiyetdyy
    rkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
    yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk