PDB entry 3ekc

View 3ekc on RCSB PDB site
Description: structure of W60V beta-2 microglobulin mutant
Class: immune system
Keywords: beta-2-microglobulin, tryptophan, glycine, amyloidosis, DRA, beta fibrils, Disease mutation, Glycation, Glycoprotein, Immune response, Immunoglobulin domain, MHC I, Pyrrolidone carboxylic acid, Secreted, IMMUNE SYSTEM
Deposited on 2008-09-19, released 2009-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: NM_004048
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • initiating methionine (0)
      • engineered (60)
    Domains in SCOPe 2.08: d3ekca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ekcA (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    vsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm