PDB entry 3ek2

View 3ek2 on RCSB PDB site
Description: Crystal structure of eonyl-(acyl carrier protein) reductase from burkholderia pseudomallei 1719b
Class: oxidoreductase
Keywords: SSGCID, enoyl-(acyl carrier protein) reductase, Oxidoreductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2008-09-18, released 2008-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-(Acyl-carrier-protein) reductase (NADH)
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ek2a_
  • Chain 'B':
    Compound: Enoyl-(Acyl-carrier-protein) reductase (NADH)
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ek2b_
  • Chain 'C':
    Compound: Enoyl-(Acyl-carrier-protein) reductase (NADH)
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ek2c_
  • Chain 'D':
    Compound: Enoyl-(Acyl-carrier-protein) reductase (NADH)
    Species: Burkholderia pseudomallei 1710b [TaxId:320372]
    Gene: fabI, BURPS1710b_2636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ek2d_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ek2A (A:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ek2A (A:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpisgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevm
    hvdsgfnavvggm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ek2B (B:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ek2B (B:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpikfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevmhvds
    gfnavvggm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ek2C (C:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ek2C (C:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktsfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevmhv
    dsgfnavvggm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ek2D (D:)
    mahhhhhhmgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefa
    aefgselvfpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltren
    friahdisaysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvry
    lavslgakgvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafl
    lsdlasgvtaevmhvdsgfnavvggmaglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ek2D (D:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevmhvd
    sgfnavvggm