PDB entry 3ejw

View 3ejw on RCSB PDB site
Description: Crystal Structure of the Sinorhizobium meliloti AI-2 receptor, SmLsrB
Class: signaling protein
Keywords: Periplasmic binding protein, Plasmid, SIGNALING PROTEIN
Deposited on 2008-09-18, released 2008-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-02, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SmLsrB
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: AitB, RB0590, SM_b21016, SMb21016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ejwa_
  • Chain 'B':
    Compound: SmLsrB
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: AitB, RB0590, SM_b21016, SMb21016
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ejwb_
  • Heterogens: PAV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ejwA (A:)
    enqiafipklvgvgfftsggagavkageevgakvtydgptepsvsgqvqfinnfvnqgyn
    alivssvspdglcpalkramergvlvmtwdsdvnpdcrsyyinqgtpeqlggllvdmaae
    gvkkekakvaffyssptvtdqnawaeaakakiakehpgweivttqygyndaqkslqtaes
    ilqtypdldaiiapdanalpaaaqaaenlkraegvtivgfstpnvmrpyiergtiqrfgl
    wdvtqqgkisvfvadhvlkngpmkvgekleipgvgtvevsankvqgydyeadgngiillp
    ertvftkenignfdf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ejwB (B:)
    enqiafipklvgvgfftsggagavkageevgakvtydgptepsvsgqvqfinnfvnqgyn
    alivssvspdglcpalkramergvlvmtwdsdvnpdcrsyyinqgtpeqlggllvdmaae
    gvkkekakvaffyssptvtdqnawaeaakakiakehpgweivttqygyndaqkslqtaes
    ilqtypdldaiiapdanalpaaaqaaenlkraegvtivgfstpnvmrpyiergtiqrfgl
    wdvtqqgkisvfvadhvlkngpmkvgekleipgvgtvevsankvqgydyeadgngiillp
    ertvftkenignfdf