PDB entry 3ejn

View 3ejn on RCSB PDB site
Description: crystal structure of a susd homolog (bf3025) from bacteroides fragilis nctc 9343 at 1.50 a resolution
Class: sugar binding protein
Keywords: susd homolog, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, sugar binding protein
Deposited on 2008-09-18, released 2008-09-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.155
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SusD homolog
    Species: Bacteroides fragilis NCTC 9343 [TaxId:272559]
    Gene: YP_212639.1, BF3025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ejna1
  • Heterogens: PG4, FMT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ejnA (A:)
    ggnleemnidpdnatqthpkllltqicmnafkrgtdgmyatkkviqadgesadqyykwtr
    gsfgyydnlrnvqkmgeeaervnapvytaltkffrayyfyeltlrfgdipysqalkgeke
    eiytpeydaqedvfagilqelreadeilandasvidgdiiyngnstqwrklinsfrlkvl
    mtlsnhttvgniniasefkniatnsplmnsladngqlvyldqqgnrypqfnaqwsgyymd
    dtfiqrmrerrdprlfifsaqtnkgktegkpiddfssyeggdpaapysdaiikvsegtis
    pindrfrtdpiveptmlmgyaelqqilaeavvrgwisgnaqtyyekgirasfsfyethak
    dyagylnenavaqylkeplvdftqasgteeqieriimqkylvtfyqgnwdsfyeqlrtgy
    pdfrrpagteipkrwmypqgeydnngtnvetaitrqfgagndkinqatwwqkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejnA (A:)
    qthpkllltqicmnafkrgtdgmyatkkviqadgesadqyykwtrgsfgyydnlrnvqkm
    geeaervnapvytaltkffrayyfyeltlrfgdipysqalkytpeydaqedvfagilqel
    readeilandasvidgdiiyngnstqwrklinsfrlkvlmtlsnhttvgniniasefkni
    atnsplmnsladngqlvyldqqgnrypqfnaqwsgyymddtfiqrmrerrdprlfifsaq
    tnkgktegkpiddfssyeggdpaapysdaiikvsispindrfrtdpiveptmlmgyaelq
    qilaeavvrgwisgnaqtyyekgirasfsfyethakdyagylnenavaqylkeplvdftq
    asgteeqieriimqkylvtfyqgnwdsfyeqlrtgypdfrrpagteipkrwmypqgeydn
    ngtnvetaitrqfgagndkinqatwwqkks