PDB entry 3ejm

View 3ejm on RCSB PDB site
Description: Crystal structure of the mimivirus NDK +Kpn mutant complexed with GDP
Class: transferase
Keywords: NDK Mimivirus phosphotransferase nucleotide binding, ATP-binding, Kinase, Magnesium, Metal-binding, Nucleotide metabolism, Nucleotide-binding, Phosphoprotein, Transferase
Deposited on 2008-09-18, released 2009-08-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
    Gene: NDK, MIMI_R418
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UQL3 (6-End)
      • expression tag (5)
      • see remark 999 (95-96)
      • see remark 999 (98)
      • see remark 999 (100-102)
    Domains in SCOPe 2.03: d3ejma_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
    Gene: NDK, MIMI_R418
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UQL3 (6-End)
      • expression tag (5)
      • see remark 999 (95-96)
      • see remark 999 (98)
      • see remark 999 (100-102)
    Domains in SCOPe 2.03: d3ejmb_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ejmA (A:)
    ykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehse
    qsyfndncdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenli
    hasdsedsavdeisiwfpetkmetdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejmA (A:)
    lqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfn
    dncdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasds
    edsavdeisiwfpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ejmB (B:)
    ykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehse
    qsyfndncdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenli
    hasdsedsavdeisiwfpetkmetdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejmB (B:)
    lqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfn
    dncdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasds
    edsavdeisiwfpe