PDB entry 3eji

View 3eji on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L36K at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, Calcium, Endonuclease, Metal-binding, Nuclease, Secreted, Zymogen
Deposited on 2008-09-18, released 2008-11-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc, SAR0847
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GIK1
      • engineered (35)
      • engineered (43-44)
      • engineered (110)
      • engineered (121)
    Domains in SCOPe 2.01: d3ejia_
  • Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ejiA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrkllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejiA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrkllvdtpefnekygpeasaftkkmvenakk
    ievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
    akkeklniws